Auteur Sujet: Notification courriel flaggée comme SPAM avec OVHcloud  (Lu 1057 fois)

0 Membres et 1 Invité sur ce sujet

austinforest

  • Abonné Orange Fibre
  • *
  • Messages: 112
  • Paris 75
Bonjour,
Depuis ce matin, les notifications par mail sont flaggées comme SPAM chez moi.
Mon courriel est hébergé chez OVHcloud.
Dites-moi si je peux aider.

rooot

  • Abonné RED by SFR fibre FttH
  • *
  • Messages: 1 951
  • 🔵🔵🔵🔵⚪⚪⚪⚪🔴🔴🔴🔴
Notification courriel flaggée comme SPAM avec OVHcloud
« Réponse #1 le: 20 mai 2024 à 11:21:26 »
Depuis ce matin, les notifications par mail sont flaggées comme SPAM chez moi.
de quoi il s'agit exactement ?

quel rapport avec la section "Évolution de LaFibre.info, bugs et critiques" ? il y a une section ovhcloud ici : https://lafibre.info/ovh-datacenter/

robin4002

  • Abonné Orange Fibre
  • *
  • Messages: 863
  • Strasbourg (67)
Notification courriel flaggée comme SPAM avec OVHcloud
« Réponse #2 le: 20 mai 2024 à 12:06:33 »
Il est possible d'activer dans les paramètres de son compte des notifications par mail lorsque des événements arrivent sur le forum (réponse à une discussion suivie, mp reçu, etc).
OVHCloud propose une solution mail hébergé.

Là le problème c'est que les mails envoyés par lafibre.info sont considérés comme spam par les serveurs de mail d'ovh, donc il faudrait que Vivien regarde si l'IP utilisé par le serveur de mail de lafibre.info ne se serait pas retrouvé sur une liste noire.

rooot

  • Abonné RED by SFR fibre FttH
  • *
  • Messages: 1 951
  • 🔵🔵🔵🔵⚪⚪⚪⚪🔴🔴🔴🔴
Notification courriel flaggée comme SPAM avec OVHcloud
« Réponse #3 le: 20 mai 2024 à 13:29:00 »
Il est possible d'activer dans les paramètres de son compte des notifications par mail lorsque des événements arrivent sur le forum (réponse à une discussion suivie, mp reçu, etc).
OVHCloud propose une solution mail hébergé.

Là le problème c'est que les mails envoyés par lafibre.info sont considérés comme spam par les serveurs de mail d'ovh, donc il faudrait que Vivien regarde si l'IP utilisé par le serveur de mail de lafibre.info ne se serait pas retrouvé sur une liste noire.
ha ok compris !!

en fait ovh passe par vadesecure pour determiner si un mail est un spam. du coup dans l'entete du mail vous devriez trouver un parametre : spamcause ou X-VR-SPAMCAUSE suivi d'une ribambelle de lettres qui en fait correspond à la raison du spam. il est possible de le décoder pour comprendre les raisons exactes de la classification en spam. Si vous pouvez poster (ou en MP) cette serie de lettres je peux vous le décoder j'ai un outil pour ça.

il doit y avoir aussi un X-VR-SPAMSCORE, en fonction de cette valeur le tag [SPAM] apparaitra. Vous pourrez en savoir plus sur le principe ici : https://services.renater.fr/antispam/refdocs/marquages

alain_p

  • Abonné Free fibre
  • *
  • Messages: 16 496
  • Delta S 10G-EPON sur Les Ulis (91)
Notification courriel flaggée comme SPAM avec OVHcloud
« Réponse #4 le: 20 mai 2024 à 13:48:11 »
En fait, pour afficher les en-têtes, c'est par exemple Ctrl-U dans Thunderbird.

Après, vous pouvez les copier ici, en enlevant les informations personnelles, pour que l'on examine les raisons du classements en spam par OVH.

rooot

  • Abonné RED by SFR fibre FttH
  • *
  • Messages: 1 951
  • 🔵🔵🔵🔵⚪⚪⚪⚪🔴🔴🔴🔴
Notification courriel flaggée comme SPAM avec OVHcloud
« Réponse #5 le: 20 mai 2024 à 14:37:49 »
et dans Outlook on double clic sur le mail pour l'ouvrir dans une fenetre séparée. Puis on clique sur l'onglet FICHIER, puis Propriété.

voici un exemple sur un spam reçu :


Denis M

  • Abonné RED by SFR fibre FttH
  • *
  • Messages: 1 273
  • Sermaise 91530
Notification courriel flaggée comme SPAM avec OVHcloud
« Réponse #6 le: 20 mai 2024 à 20:58:20 »
Bonsoir,

il existe déjà un topic assez proche causant de prétendus spams de La Fibre: https://lafibre.info/evolution/plus-de-mails-de-notifications-de-suivi-de-sujet-depuis-le-2603/


austinforest

  • Abonné Orange Fibre
  • *
  • Messages: 112
  • Paris 75
Notification courriel flaggée comme SPAM avec OVHcloud
« Réponse #7 le: 21 mai 2024 à 10:11:18 »
Bonjour,
ça s'est calmé de mon côté dernièrement (les notifs par mail ne sont plus flaggées).
Voici ce que ça donnait sur un courriel de notification en date du 13 mai

X-VR-SPAMSTATE: SPAM
X-VR-SPAMSCORE: 301
X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvledrvdeggedggeefucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuqfggjfdpvefjgfevmfevgfenuceurghilhhouhhtmecuhedttdenucgoufhprghmkfhppfgvthifohhrkhculddvhedtmdenqfhnlhihuchonhgvuchprghrthculdehuddmnecujfgurhepvffuhfffkffogggtgfesrgejreerredtjeenucfhrhhomhepfdfnrgcuhfhisghrvgdfuceonhgvqdhprghsqdhrvghpohhnughrvgeslhgrfhhisghrvgdrihhnfhhoqeenucggtffrrghtthgvrhhnpeekteettdfhgfetteehudfhheeugfduheehiefhjeelfeefvdevfeelffdvjeeujeenucffohhmrghinheplhgrfhhisghrvgdrihhnfhhonecukfhppeektddrieejrdduieejrdejjeenucfuphgrmhfkphfpvghtfihorhhkpeektddrieejrdduieejrdejjeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeektddrieejrdduieejrdejjedphhgvlhhopehlrghfihgsrhgvrdhinhhfohdpmhgrihhlfhhrohhmpeiffiifqdgurghtrgeslhgrfhhisghrvgdrihhnfhhopdhnsggprhgtphhtthhopedupdhrtghpthhtohepjhgvrhgvmhihsghonhgrnhesvghpihgtghgvvghkrdgvuhdpoffvtefjohhsthepvhhrudelpdgukhhimhepnhhonhgvpdhsphhfpehprghsshdprhgvvhfkrfeplhgrfhhisghrvgdrihhnfhhopdhgvghokffrpefhtf
X-Ovh-Spam-Status: SPAM
X-Ovh-Spam-Reason: vr: SPAM; dkim: OK; spf: disabled
X-Ovh-Message-Type: SPAM
X-Spam-Tag: YES
Return-Path: www-data@lafibre.info


rooot

  • Abonné RED by SFR fibre FttH
  • *
  • Messages: 1 951
  • 🔵🔵🔵🔵⚪⚪⚪⚪🔴🔴🔴🔴
Notification courriel flaggée comme SPAM avec OVHcloud
« Réponse #8 le: 21 mai 2024 à 11:59:29 »
Vade Retro 01.429.244#43 AS+AV+AP+RT Profile: OVH,CHECKCE
Bailout: 500
^SpamIpNetwork (250)
Only one part (51)
Hdr=TSFDIMVcE@a7???07
From="La Fibre" <ne-pas-repondre@lafibre.info>
VRPattern=8AA0FEAA51F5BE1556F79332C39D27B7
Domain=lafibre.info
Ip=80.67.167.77
SpamIpNetwork=80.67.167.77
ClusterSize=0
Param=inet=80.67.167.77,helo=lafibre.info,mailfrom=www-data@lafibre.info,nb_rcptto=1,rcptto=XXXXXXXXXXXXX,MTAHost=vr19,dkim=none,spf=pass,revIP=lafibre.info,geoIP=FR

SpamIpNetwork  --> l'adresse ip de l'expéditeur est classifiée comme spammeur chez Vadesecure

Hugues

  • AS2027 MilkyWan
  • Modérateur
  • *
  • Messages: 12 530
  • Lyon (69) / St-Bernard (01)
    • Twitter
Notification courriel flaggée comme SPAM avec OVHcloud
« Réponse #9 le: 21 mai 2024 à 12:04:45 »
Comment dire...


rooot

  • Abonné RED by SFR fibre FttH
  • *
  • Messages: 1 951
  • 🔵🔵🔵🔵⚪⚪⚪⚪🔴🔴🔴🔴
Notification courriel flaggée comme SPAM avec OVHcloud
« Réponse #10 le: 21 mai 2024 à 12:10:06 »
ca a changé entre temps je pense, de mon coté pour mon serveur exchange hebergé chez OVH, régulièrement je suis emmerdé pour un oui pour un non par UCEPROTECTL3

Citer
If you are on the UCEPROTECTL2/L3, you have an IP address from your ISP that falls into a poor reputation range (i.e., the entire range of IP addresses is blocked as a result of the provider hosting spammers).

Déjà mettre un DMARC ca aiderait a baisser le score...

ppn_sd

  • Abonné RED by SFR fibre FttH
  • *
  • Messages: 173
  • FLG (28190)
Notification courriel flaggée comme SPAM avec OVHcloud
« Réponse #11 le: 21 mai 2024 à 12:52:45 »
Vade-Secure cite Abusix et Senderscore en sources de listes ip, en plus de la leur :
https://postmaster-oxsus.vadesecure.com/inbound_error_codes/

Ces intermédiaires sont vraiment la plaie.